PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca50076.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 331aa    MW: 38056.2 Da    PI: 5.2945
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca50076.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.93.4e-5261321128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 lppGfrFhPtdee+v +yLk+kve+ ++el e+i+e++ yk++Pw+Lp k  + +++ ew+fF++rd+ky++g+r+nratk+gyWkatgkd++v +  +
  Dca50076.1   6 LPPGFRFHPTDEEIVGYYLKRKVEKLEIEL-EIIPEIEFYKFDPWELPdKsFLPKRDMEWFFFCPRDRKYPNGSRTNRATKAGYWKATGKDRKVAC--E 101
                 79****************************.99**************96434556788************************************99..7 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 +++g +ktLvfy+grap g++tdWvmheyrl
  Dca50076.1 102 TVTGFRKTLVFYQGRAPLGNRTDWVMHEYRL 132
                 89***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.12E-554151IPR003441NAC domain
PROSITE profilePS5100557.0646151IPR003441NAC domain
PfamPF023652.3E-297132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MGGATLPPGF RFHPTDEEIV GYYLKRKVEK LEIELEIIPE IEFYKFDPWE LPDKSFLPKR  60
DMEWFFFCPR DRKYPNGSRT NRATKAGYWK ATGKDRKVAC ETVTGFRKTL VFYQGRAPLG  120
NRTDWVMHEY RLSDDTQNVY GAFALCRVVK RNGFNEGVKA KRVGSHSGNK DSVPSEVSNE  180
PLSISSDYQY NSSNYSSPIS SPYITPRAEI EATTSVNTIS SNMWVSPELI LDSSKEYSQG  240
KKMPYDYNPR WEIEDSATQW QPCQQQQQGI SPSTSYSNFG EIERFDNLNQ IGCLSPYSAN  300
MDYMGFYENV GTFYESYDGN NTLNYQNPSS F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B4e-49515216166NAC domain-containing protein 19
4dul_A4e-49515216166NAC domain-containing protein 19
1ut7_B4e-49515216166NO APICAL MERISTEM PROTEIN
1ut7_A4e-49515216166NO APICAL MERISTEM PROTEIN
1ut4_B4e-49515216166NO APICAL MERISTEM PROTEIN
1ut4_A4e-49515216166NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00546DAPTransfer from AT5G46590Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010677286.11e-167PREDICTED: NAC domain-containing protein 86
TrEMBLA0A088FL450.0A0A088FL45_9CARY; Putative NAC transcription factor
STRINGVIT_02s0012g01040.t011e-135(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.11e-77NAC domain containing protein 71